Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109335 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tripartite Motif Containing 32 (TRIM32) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32.
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCV
DARGDLIVADSSRKE- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Homozygosity mapping with SNP arrays identifies TRIM32, an E3 ubiquitin ligase, as a Bardet-Biedl syndrome gene (BBS11).
Chiang AP, Beck JS, Yen HJ, Tayeh MK, Scheetz TE, Swiderski RE, Nishimura DY, Braun TA, Kim KY, Huang J, Elbedour K, Carmi R, Slusarski DC, Casavant TL, Stone EM, Sheffield VC
Proceedings of the National Academy of Sciences of the United States of America 2006 Apr 18;103(16):6287-92
Proceedings of the National Academy of Sciences of the United States of America 2006 Apr 18;103(16):6287-92
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human 293T; WB Suggested Anti-TRIM32 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Transfected 293T. TRIM32 is supported by BioGPS gene expression data to be expressed in HEK293T.; TRIM32 antibody - C-terminal region (AP42053PU-N) in Human 293T cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Bronchial Epithelial Tissue; Rabbit Anti-TRIM32 Antibody . . Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue . Observed Staining: Cytoplasmic . Primary Antibody Concentration: 1:100 . Secondary Antibody: Donkey anti-Rabbit-Cy3 . Secondary Antibody Concentration: 1:200 . Magnification: 20X . Exposure Time: 0.5 - 2.0 sec .; Rabbit Anti-TRIM32 Antibody (AP42053PU-N) ) in Human Bronchial Epithelial Tissue using Immunohistochemistry