Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001982-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001982-M01, RRID:AB_606172
- Product name
- EIF4G2 monoclonal antibody (M01), clone 3B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EIF4G2.
- Antigen sequence
SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPK
GMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGK
GKALFQVNQ- Isotype
- IgG
- Antibody clone number
- 3B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
Katsogiannou M, Andrieu C, Baylot V, Baudot A, Dusetti NJ, Gayet O, Finetti P, Garrido C, Birnbaum D, Bertucci F, Brun C, Rocchi P
Molecular & cellular proteomics : MCP 2014 Dec;13(12):3585-601
Molecular & cellular proteomics : MCP 2014 Dec;13(12):3585-601
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EIF4G2 monoclonal antibody (M01), clone 3B5. Western Blot analysis of EIF4G2 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to EIF4G2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol