HPA016965

EIF4G2 antibody from Sigma-Aldrich
DAP5, NAT1, p97
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016965
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016965, RRID:AB_1848100
Product name
Anti-EIF4G2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016965
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 4 gamma 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQST
TFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEE
EEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKC
IKTLLEKKKRVQLKDMGEDLECLCQIMRTVGPRLD
HERAKS
Storage
-20C
Provider Type Product Number
- No reagents -