HPA018423

SLC39A5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018423
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018423, RRID:AB_1857154
Product name
Anti-SLC39A5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018423
Antibody type
Polyclonal
Antigen
Zinc transporter ZIP5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTG
RAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWG
DLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADH
LNEDCLNGSQLLVNFGLSPAAPLTPR
Storage
-20C
Provider Type Product Number
- No reagents -