Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005565 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005565, RRID:AB_2078680
- Product name
- Anti-CDCA7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PKFRSDISEELANVFYEDSDNESFCGFSESEVQDV
LDHCGFLQKPRPDVTNELAGIFHADSDDESFCGFS
ESEIQDGM- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome.
The MYC-associated protein CDCA7 is phosphorylated by AKT to regulate MYC-dependent apoptosis and transformation.
Shubbar E, Kovács A, Hajizadeh S, Parris TZ, Nemes S, Gunnarsdóttir K, Einbeigi Z, Karlsson P, Helou K
BMC cancer 2013 Jan 2;13:1
BMC cancer 2013 Jan 2;13:1
The MYC-associated protein CDCA7 is phosphorylated by AKT to regulate MYC-dependent apoptosis and transformation.
Gill RM, Gabor TV, Couzens AL, Scheid MP
Molecular and cellular biology 2013 Feb;33(3):498-513
Molecular and cellular biology 2013 Feb;33(3):498-513
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows strong nuclear and cytopalsmic positivity in germinal and non-germinal center cells.