HPA005565

CDCA7 antibody from Atlas Antibodies
FLJ14736, JPO1

Antibody data

Product number
HPA005565
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005565, RRID:AB_2078680
Product name
Anti-CDCA7
Provider product page
Atlas Antibodies - HPA005565
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PKFRSDISEELANVFYEDSDNESFCGFSESEVQDV
LDHCGFLQKPRPDVTNELAGIFHADSDDESFCGFS
ESEIQDGM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.