HPA005565

CDCA7 antibody from Sigma-Aldrich
FLJ14736, JPO1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005565
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005565, RRID:AB_2078680
Product name
Anti-CDCA7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005565
Antibody type
Polyclonal
Antigen
Cell division cycle-associated protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKFRSDISEELANVFYEDSDNESFCGFSESEVQDV
LDHCGFLQKPRPDVTNELAGIFHADSDDESFCGFS
ESEIQDGM
Storage
-20C
Provider Type Product Number
- No reagents -