Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA022268 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA022268, RRID:AB_1845225
- Product name
- Anti-LPCAT1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARL
VRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF
AASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVA
LSV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references AAV-mediated lysophosphatidylcholine acyltransferase 1 (Lpcat1) gene replacement therapy rescues retinal degeneration in rd11 mice.
Loss of lysophosphatidylcholine acyltransferase 1 leads to photoreceptor degeneration in rd11 mice.
Dai X, Han J, Qi Y, Zhang H, Xiang L, Lv J, Li J, Deng WT, Chang B, Hauswirth WW, Pang JJ
Investigative ophthalmology & visual science 2014 Mar 20;55(3):1724-34
Investigative ophthalmology & visual science 2014 Mar 20;55(3):1724-34
Loss of lysophosphatidylcholine acyltransferase 1 leads to photoreceptor degeneration in rd11 mice.
Friedman JS, Chang B, Krauth DS, Lopez I, Waseem NH, Hurd RE, Feathers KL, Branham KE, Shaw M, Thomas GE, Brooks MJ, Liu C, Bakeri HA, Campos MM, Maubaret C, Webster AR, Rodriguez IR, Thompson DA, Bhattacharya SS, Koenekoop RK, Heckenlively JR, Swaroop A
Proceedings of the National Academy of Sciences of the United States of America 2010 Aug 31;107(35):15523-8
Proceedings of the National Academy of Sciences of the United States of America 2010 Aug 31;107(35):15523-8
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines PC-3 and Caco-2 using Anti-LPCAT1 antibody. Corresponding LPCAT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human lung and liver tissues using HPA022268 antibody. Corresponding LPCAT1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, kidney, liver and lung using Anti-LPCAT1 antibody HPA022268 (A) shows similar protein distribution across tissues to independent antibody HPA012501 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN