Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503099 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Lysophosphatidylcholine Acyltransferase 1 (LPCAT1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LPCAT1 antibody: synthetic peptide directed towards the middle region of human LPCAT1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSE
RARMK GGEKIGIAEF- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mammalian acyl-CoA:lysophosphatidylcholine acyltransferase enzymes.
Soupene E, Fyrst H, Kuypers FA
Proceedings of the National Academy of Sciences of the United States of America 2008 Jan 8;105(1):88-93
Proceedings of the National Academy of Sciences of the United States of America 2008 Jan 8;105(1):88-93
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting