HPA022268

LPCAT1 antibody from Sigma-Aldrich
AGPAT10, AGPAT9, AYTL2, FLJ12443
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022268
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022268, RRID:AB_1845225
Product name
Anti-AYTL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022268
Antibody type
Polyclonal
Antigen
1-acylglycerophosphocholine O-acyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARL
VRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF
AASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVA
LSV
Storage
-20C
Provider Type Product Number
- No reagents -