H00004149-D01P
antibody from Abnova Corporation
Targeting: MAX
bHLHd4, bHLHd5, bHLHd6, bHLHd7, bHLHd8
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004149-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004149-D01P, RRID:AB_1677205
- Product name
- MAX purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human MAX protein.
- Antigen sequence
MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFH
SLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNH
THQQDIDDLKRQNALLEQQVRALEKARSSAQLQTN
YPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEP
QSRKKLRMEAS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Pattern recognition receptor mediated downregulation of microRNA-650 fine-tunes MxA expression in dendritic cells infected with influenza A virus.
Pichulik T, Khatamzas E, Liu X, Brain O, Delmiro Garcia M, Leslie A, Danis B, Mayer A, Baban D, Ragoussis J, Weber AN, Simmons A
European journal of immunology 2016 Jan;46(1):167-77
European journal of immunology 2016 Jan;46(1):167-77
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MAX expression in transfected 293T cell line (H00004149-T02) by MAX MaxPab polyclonal antibody.Lane 1: MAX transfected lysate(17.20 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between MAX and SMAD3. HeLa cells were stained with anti-MAX rabbit purified polyclonal 1:1200 and anti-SMAD3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)