HPA003474

MAX antibody from Atlas Antibodies
bHLHd4, bHLHd5, bHLHd6, bHLHd7, bHLHd8

Antibody data

Product number
HPA003474
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003474, RRID:AB_1079317
Product name
Anti-MAX
Provider product page
Atlas Antibodies - HPA003474
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKR
RDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEY
IQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKA
RSSAQLQTNYPSSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.