HPA006401

ALDH4A1 antibody from Sigma-Aldrich
ALDH4, P5CDh
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006401
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006401, RRID:AB_1844731
Product name
Anti-ALDH4A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006401
Antibody type
Polyclonal
Antigen
Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSLLNKAIEAALAARKEWDLKPIADRAQIFLKAAD
MLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELID
FFRFNAKYAVELEGQQPISVPPSTNSTVYRGLE
Storage
-20C
Provider Type Product Number
- No reagents -