Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 18-272-196681 - Provider product page
- Provider
- GenWay
- Product name
- IL21
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide: CRHLIDIVEQLKIYENDLDPELLSAPQDVK , corresponding to N terminal amino acids 32-61 of Mouse IL21.
- Description
- Immunogen affinity purified
- Reactivity
- Mouse
- Host
- Goat
- Isotype
- IgG
- Vial size
- 0.05 mg
- Storage
- Keep as concentrated solution. Store at 4C short term. For extended storage aliquot and store at -20C or below. Avoid freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data