Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN301734 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interleukin 21 (IL21) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to N-terminus of human IL-21.
- Description
- Immunoaffinity Chromatography
- Reactivity
- Human
- Host
- Goat
- Epitope
- N-Term
- Isotype
- IgG
- Vial size
- 50 μg
- Storage
- Long term: -20°C, Short term: +4°C, Avoid freeze-thaw cycles.
- Handling
- Avoid repeat freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data