ABIN301734

antibody from antibodies-online

Targeting: IL21 IL-21, Za11

ELISA

Antibody data

Submit

Validation data

Product number: ABIN301734 - Provider product page
Provider: antibodies-online
Product name: anti-Interleukin 21 (IL21) (N-Term) antibody
Antibody type: Polyclonal
Antigen: Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to N-terminus of human IL-21.
Description: Immunoaffinity Chromatography
Reactivity: Human
Host: Goat
Epitope: N-Term
Isotype: IgG
Vial size: 50 μg
Storage: Long term: -20°C, Short term: +4°C, Avoid freeze-thaw cycles.
Handling: Avoid repeat freeze-thaw cycles.

IL21 protein structure - ABIN301734 shown in red.