Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Immunocytochemistry [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - PAB28387 - Provider product page

 - Provider
 - Abnova Corporation
 - Product name
 - ASB2 polyclonal antibody
 - Antibody type
 - Polyclonal
 - Antigen
 - Recombinant protein corresponding to amino acids of human ASB2.
 - Reactivity
 - Human
 - Host
 - Rabbit
 - Antigen sequence
 FHSCSAPSRSTAPPESSPARAPMGLFQGVMQKYSS
SLFKTSQLAPADPLIKAIKDGDEEALKTMIKEGKN
LAEPNKEGWLPLHEAAYYGQVGCLKVLQRAYPGTI
DQRTLQEETAVYLATCRGHLDCLLSLLQAGAEPDI
SNK- Isotype
 - IgG
 - Vial size
 - 100 µl
 - Storage
 - Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunofluorescent staining of human cell line A-431 with ASB2 polyclonal antibody (Cat # PAB28387) at 1-4 ug/ml shows positivity in nucleoli.
 - Validation comment
 - Immunofluorescence
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunohistochemical staining of human corpus with ASB2 polyclonal antibody (Cat # PAB28387) shows cytoplasmic positivity with a granular pattern in glandular cells at 1:50-1:200 dilution.
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)