HPA001546

ASB2 antibody from Sigma-Aldrich
ASB-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001546
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001546, RRID:AB_1078224
Product name
Anti-ASB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001546
Antibody type
Polyclonal
Antigen
Ankyrin repeat and SOCS box protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHSCSAPSRSTAPPESSPARAPMGLFQGVMQKYSS
SLFKTSQLAPADPLIKAIKDGDEEALKTMIKEGKN
LAEPNKEGWLPLHEAAYYGQVGCLKVLQRAYPGTI
DQRTLQEETAVYLATCRGHLDCLLSLLQAGAEPDI
SNK
Storage
-20C
Provider Type Product Number
- No reagents -