HPA018327

CBLB antibody from Sigma-Aldrich
Cbl-b, RNF56
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018327
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018327, RRID:AB_1846097
Product name
Anti-CBLB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018327
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase CBL-B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPA
RRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPK
PRPRRTAPEIHHRKP
Storage
-20C
Provider Type Product Number
- No reagents -