HPA058595

ELF4 antibody from Atlas Antibodies
ELFR, MEF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA058595
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA058595, RRID:AB_2683768
Product name
Anti-ELF4
Provider product page
Atlas Antibodies - HPA058595
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLE
LGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSV
PSNIHLGVA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -