PAB29473

ELF4 antibody from Abnova Corporation
ELFR, MEF

Antibody data

Product number
PAB29473
Provider
Abnova Corporation
Product name
ELF4 polyclonal antibody
Provider product page
Abnova Corporation - PAB29473
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant human ELF4.
Antigen sequence
SSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLE
LGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSV
PSNIHLGVA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -