Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502657 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NR0B2 antibody: synthetic peptide directed towards the N terminal of human NR0B2
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
STSQPGACPCQGAASRPAILYALLSSSLKAVPRPR
SRCLC RQHRPVQLCA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Bile acid regulates c-Jun expression through the orphan nuclear receptor SHP induction in gastric cells.
Park WI, Park MJ, An JK, Choi YH, Kim HY, Cheong J, Yang US
Biochemical and biophysical research communications 2008 May 2;369(2):437-43
Biochemical and biophysical research communications 2008 May 2;369(2):437-43
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting