Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310226 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7
- Description
- Protein A purified
- Reactivity
- Human, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSE
THKAL SDLELMAQSI- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references CYP3A7 protein expression is high in a fraction of adult human livers and partially associated with the CYP3A7*1C allele.
Sim SC, Edwards RJ, Boobis AR, Ingelman-Sundberg M
Pharmacogenetics and genomics 2005 Sep;15(9):625-31
Pharmacogenetics and genomics 2005 Sep;15(9):625-31
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting