Antibody data

Product number
H00005164-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005164-M01, RRID:AB_489887
Product name
PDK2 monoclonal antibody (M01), clone 2G1
Provider product page
Abnova Corporation - H00005164-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PDK2.
Antigen sequence
HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPD
LEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNA
MRATVESHESSLILPPIKVM
Isotype
IgG
Antibody clone number
2G1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -