Antibody data

Product number
H00005164-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005164-M03, RRID:AB_1136986
Product name
PDK2 monoclonal antibody (M03), clone 2D12
Provider product page
Abnova Corporation - H00005164-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PDK2.
Antigen sequence
MRWVWALLKNASLAGAPKYIEHFSKFSPSPLSMKQ
FLDFGSSNACEKASFTFLRQELPVRLANIMKEINL
LPDRVLSTPSVQLVQSWYVQSLLDIMKFLDKDPED
HRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDT
YGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLI
FDGSTNPAHPKHIGSIDPNCNVSEVVKDAYDMAKL
LCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHL
YHMLFELFKNAMRATVESHESSLILPPIKVMVALG
EEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPTPQ
PGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSME
GFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQTI
QEAGDWCVPSTEPKNTSTYRVS
Isotype
IgG
Antibody clone number
2D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -