HPA008287

PDK2 antibody from Sigma-Aldrich
PDHK2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008287
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008287, RRID:AB_1079589
Product name
Anti-PDK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008287
Antibody type
Polyclonal
Antigen
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTSFTFLRQELPVRLANIMKEINLLPDRVLSTPSV
QLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDAL
VTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNI
QYFLDRFYLSRISIRMLINQHTLIFDGSTN
Storage
-20C
Provider Type Product Number
- No reagents -