HPA011994

MGLL antibody from Sigma-Aldrich
HU-K5, MGL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011994
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011994, RRID:AB_1853916
Product name
Anti-MGLL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011994
Antibody type
Polyclonal
Antigen
Monoglyceride lipase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQHIMETGPEDPSSMPEESSPRRTPQSIPYQDLPH
LVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSG
RYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVS
DFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSM
Storage
-20C
Provider Type Product Number
- No reagents -