Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182554 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Sirtuin 1 (SIRT1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SIRT1 antibody: synthetic peptide directed towards the N terminal of human SIRT1
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
PETIPPPELDDMTLWQIVINILSEPPKRKKRKDIN
TIEDA VKLLQECKKI- Vial size
- 50 µg
Submitted references Butyric acid-induced rat jugular blood cytosolic oxidative stress is associated with SIRT1 decrease.
Changes in energy-regulated molecules in the trophocytes and fat cells of young and old worker honeybees (Apis mellifera).
Inhibition of SIRT1 catalytic activity increases p53 acetylation but does not alter cell survival following DNA damage.
Risk assessment in patients with depressed left ventricular function after myocardial infarction using the myocardial performance index--Survival and Ventricular Enlargement (SAVE) experience.
Cueno ME, Imai K, Tamura M, Ochiai K
Cell stress & chaperones 2014 Mar;19(2):295-8
Cell stress & chaperones 2014 Mar;19(2):295-8
Changes in energy-regulated molecules in the trophocytes and fat cells of young and old worker honeybees (Apis mellifera).
Hsu CY, Chuang YL
The journals of gerontology. Series A, Biological sciences and medical sciences 2014 Aug;69(8):955-64
The journals of gerontology. Series A, Biological sciences and medical sciences 2014 Aug;69(8):955-64
Inhibition of SIRT1 catalytic activity increases p53 acetylation but does not alter cell survival following DNA damage.
Solomon JM, Pasupuleti R, Xu L, McDonagh T, Curtis R, DiStefano PS, Huber LJ
Molecular and cellular biology 2006 Jan;26(1):28-38
Molecular and cellular biology 2006 Jan;26(1):28-38
Risk assessment in patients with depressed left ventricular function after myocardial infarction using the myocardial performance index--Survival and Ventricular Enlargement (SAVE) experience.
Anavekar NS, Mirza A, Skali H, Plappert T, St John Sutton M, Pfeffer MA, Solomon SD, Survival and Ventricular Enlargement (SAVE) Investigators
Journal of the American Society of Echocardiography : official publication of the American Society of Echocardiography 2006 Jan;19(1):28-33
Journal of the American Society of Echocardiography : official publication of the American Society of Echocardiography 2006 Jan;19(1):28-33
No comments: Submit comment
No validations: Submit validation data