Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182555 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Sirtuin 1 (SIRT1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SIRT1 antibody: synthetic peptide directed towards the N terminal of human SIRT1
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
PETIPPPELDDMTLWQIVINILSEPPKRKKRKDIN
TIEDA VKLLQECKKI- Vial size
- 0.1 mg
Submitted references Inhibition of SIRT1 catalytic activity increases p53 acetylation but does not alter cell survival following DNA damage.
Risk assessment in patients with depressed left ventricular function after myocardial infarction using the myocardial performance index--Survival and Ventricular Enlargement (SAVE) experience.
Solomon JM, Pasupuleti R, Xu L, McDonagh T, Curtis R, DiStefano PS, Huber LJ
Molecular and cellular biology 2006 Jan;26(1):28-38
Molecular and cellular biology 2006 Jan;26(1):28-38
Risk assessment in patients with depressed left ventricular function after myocardial infarction using the myocardial performance index--Survival and Ventricular Enlargement (SAVE) experience.
Anavekar NS, Mirza A, Skali H, Plappert T, St John Sutton M, Pfeffer MA, Solomon SD, Survival and Ventricular Enlargement (SAVE) Investigators
Journal of the American Society of Echocardiography : official publication of the American Society of Echocardiography 2006 Jan;19(1):28-33
Journal of the American Society of Echocardiography : official publication of the American Society of Echocardiography 2006 Jan;19(1):28-33
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
