HPA006295

SIRT1 antibody from Sigma-Aldrich
SIR2L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006295
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006295, RRID:AB_1079975
Product name
Anti-SIRT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006295
Antibody type
Polyclonal
Antigen
NAD-dependent deacetylase sirtuin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSR
NVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVR
KCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAE
VYSDSEDDVLSSSSCGSNSD
Storage
-20C
Provider Type Product Number
- No reagents -