Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007029 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007029, RRID:AB_1078549
- Product name
- Anti-COL6A2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TTERNNNCPEKTDCPIHVYFVLDTSESVTMQSPTD
ILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGL
HFSDQVEVFSPPGSDRASFIKNLQGISSFRRGTFT
DCALANMTEQIRQDR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Dissecting the oncogenic and tumorigenic potential of differentiated human induced pluripotent stem cells and human embryonic stem cells.
Vascular gene expression patterns are conserved in primary and metastatic brain tumors.
Ghosh Z, Huang M, Hu S, Wilson KD, Dey D, Wu JC
Cancer research 2011 Jul 15;71(14):5030-9
Cancer research 2011 Jul 15;71(14):5030-9
Vascular gene expression patterns are conserved in primary and metastatic brain tumors.
Liu Y, Carson-Walter EB, Cooper A, Winans BN, Johnson MD, Walter KA
Journal of neuro-oncology 2010 Aug;99(1):13-24
Journal of neuro-oncology 2010 Aug;99(1):13-24
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-COL6A2 antibody HPA007029 (A) shows similar pattern to independent antibody HPA030920 (B).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human colon, kidney, liver and testis using Anti-COL6A2 antibody HPA007029 (A) shows similar protein distribution across tissues to independent antibody HPA030920 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-COL6A2 antibody HPA007029.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-COL6A2 antibody HPA007029.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-COL6A2 antibody HPA007029.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-COL6A2 antibody HPA007029.
- Sample type
- HUMAN