HPA019689

AGFG2 antibody from Sigma-Aldrich
HRBL, RABR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019689
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019689, RRID:AB_1855074
Product name
Anti-AGFG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019689
Antibody type
Polyclonal
Antigen
Arf-GAP domain and FG repeats-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FGAFTNPFTAPAAQSPLPSTNPFQPNGLAPGPGFG
MSSAGPGFPQAVPPTGAFASSFPAPLFPPQTPLVQ
QQNGSSFGDLGSAKLGQRPLSQPAGISTNPFMTGP
SSSPFASKPPTTN
Storage
-20C
Provider Type Product Number
- No reagents -