HPA023597
LRBA antibody from Atlas Antibodies
BGL, CDC4L, LAB300, LBA
Validated within the Antibodypedia Validation Initative
Antibody data
- Product number
- HPA023597
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023597, RRID:AB_1853256
- Product name
- Anti-LRBA
- Provider product page
- Atlas Antibodies - HPA023597
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GGWRVWVDTLSITHSKVTFEIHKENLANIFREQQG
KVDEEIGLCSSTSVQAASGIRRDINVSVGSQQPDT
KDSPVCPHFTTNGNENSSIEKTSSLESASNIELQT
TNTSYEEMKAEQENQELPDEGTLEETL
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Deleterious Mutations in LRBA Are Associated with a Syndrome of Immune Deficiency and Autoimmunity
Lopez-Herrera G, Tampella G, Pan-Hammarström Q, Herholz P, Trujillo-Vargas C, Phadwal K, Simon A, Moutschen M, Etzioni A, Mory A, Srugo I, Melamed D, Hultenby K, Liu C, Baronio M, Vitali M, Philippet P, Dideberg V, Aghamohammadi A, Rezaei N, Enright V, Du L, Salzer U, Eibel H, Pfeifer D, Veelken H, Stauss H, Lougaris V, Plebani A, Gertz E, Schäffer A, Hammarström L, Grimbacher B
The American Journal of Human Genetics 2012 June;90(6):986-1001
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line SCLC-21H.
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LRBA antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows weak to moderate cytoplasmic positivity in lymphoid cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules, as well as weaker positivity in glomeruli.
- Sample type
- HUMAN
Enhanced validation
Supportive data in Antibodypedia
