HPA023597

LRBA antibody from Atlas Antibodies
BGL, CDC4L, LAB300, LBA
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA023597
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023597, RRID:AB_1853256
Product name
Anti-LRBA
Provider product page
Atlas Antibodies - HPA023597
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GGWRVWVDTLSITHSKVTFEIHKENLANIFREQQG
KVDEEIGLCSSTSVQAASGIRRDINVSVGSQQPDT
KDSPVCPHFTTNGNENSSIEKTSSLESASNIELQT
TNTSYEEMKAEQENQELPDEGTLEETL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -