HPA021955

CHST4 antibody from Atlas Antibodies
HEC-GLCNAC-6-ST, LSST
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021955
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021955, RRID:AB_1846723
Product name
Anti-CHST4
Provider product page
Atlas Antibodies - HPA021955
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFH
TNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNL
LGYRHVRSEQEQRNLLLDLLSTWTVPEQIH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -