Antibody data

Product number
H00010164-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010164-M10, RRID:AB_1137136
Product name
CHST4 monoclonal antibody (M10), clone 4D7
Provider product page
Abnova Corporation - H00010164-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CHST4.
Antigen sequence
LMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLE
IYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRM
YEFVGLEFLPHLQTWVHNITRGKGMGDHAF
Isotype
IgG
Antibody clone number
4D7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -