HPA021955

CHST4 antibody from Sigma-Aldrich
HEC-GLCNAC-6-ST, LSST
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021955
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021955, RRID:AB_1846723
Product name
Anti-CHST4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021955
Antibody type
Polyclonal
Antigen
Carbohydrate sulfotransferase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFH
TNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNL
LGYRHVRSEQEQRNLLLDLLSTWTVPEQIH
Storage
-20C
Provider Type Product Number
- No reagents -