Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [5]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000919-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000919-D01P, RRID:AB_1673170
- Product name
- CD247 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human CD247 protein.
- Antigen sequence
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLL
DGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ
LYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKN
PQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG
LYQGLSTATKDTYDALHMQALPPR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CD247 expression in transfected 293T cell line (H00000919-T01) by CD247 MaxPab polyclonal antibody.Lane 1: CD247 transfected lysate(18.70 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in IMR-32.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in rat brain.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in Raw 264.7.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in mouse kidney.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with anti-CD247 rabbit purified polyclonal 1:1200 and anti-CD3E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)