HPA008750

CD247 antibody from Atlas Antibodies
CD3H, CD3Q, CD3Z
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008750
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008750, RRID:AB_1857863
Product name
Anti-CD247
Provider product page
Atlas Antibodies - HPA008750
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDK
RRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYS
EIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQ
ALP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -