HPA008750

CD247 antibody from Sigma-Aldrich
CD3H, CD3Q, CD3Z
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008750
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008750, RRID:AB_1857863
Product name
Anti-CD247 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008750
Antibody type
Polyclonal
Antigen
T-cell surface glycoprotein CD3 zeta chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDK
RRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYS
EIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQ
ALP
Storage
-20C
Provider Type Product Number
- No reagents -