Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184022 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interleukin-1 Receptor-Associated Kinase 3 (IRAK3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IRAK3 antibody: synthetic peptide directed towards the C terminal of human IRAK3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVP
SIPVE DDESQNNNLL- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Tumor cells deactivate human monocytes by up-regulating IL-1 receptor associated kinase-M expression via CD44 and TLR4.
del Fresno C, Otero K, Gómez-García L, González-León MC, Soler-Ranger L, Fuentes-Prior P, Escoll P, Baos R, Caveda L, García F, Arnalich F, López-Collazo E
Journal of immunology (Baltimore, Md. : 1950) 2005 Mar 1;174(5):3032-40
Journal of immunology (Baltimore, Md. : 1950) 2005 Mar 1;174(5):3032-40
No comments: Submit comment
No validations: Submit validation data