WH0007097M7

TLR2 antibody from Sigma-Aldrich
CD282, TIL4
ELISA
Recommended by provider

Antibody data

Product number
WH0007097M7
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0007097M7, RRID:AB_1843966
Product name
Monoclonal Anti-TLR2 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0007097M7
Antibody type
Monoclonal
Antigen
TLR2 (AAH33756, a.a. 121-220) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILR
VGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYE
PKSLKSIQNVSHLILHMKQHILLLEIFVDV (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -