Antibody data

Product number
H00007097-M38
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007097-M38, RRID:AB_1137495
Product name
TLR2 monoclonal antibody (M38), clone 2G9
Provider product page
Abnova Corporation - H00007097-M38
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TLR2.
Antigen sequence
SHLILHMKQHILLLEIFVDVTSSVECLELRDTDLD
TFHFSELSTGETNSLIKKFTFRNVKITDESLFQVM
KLLNQISGLLELEFDDCTLNGVGNFRASDN
Isotype
IgG
Antibody clone number
2G9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -