HPA006659

FAM189B antibody from Atlas Antibodies
C1orf2, cote1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006659
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006659, RRID:AB_1078339
Product name
Anti-FAM189B
Provider product page
Atlas Antibodies - HPA006659
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLLPRSHSDPGITTSSDTADFRDLYTKVLEEEAAS
VSSADTGLCSEACLFRLARCPSPKLLRARSAEKRR
PVPTFQKVPLPSGPAPAHSLGDLKGSWPGRGLVTR
FLQISRKAPDPSGT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -