HPA006660

LMNA antibody from Sigma-Aldrich
CMD1A, HGPS, LGMD1B, LMN1, LMNL1, PRO1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006660
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006660, RRID:AB_1079231
Product name
Anti-LMNA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006660
Antibody type
Polyclonal
Antigen
Lamin-A/C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVVSREVSGIKAAYEAELGDARKTLDSVAKERARL
QLELSKVREEFKELKARNTKKEGDLIAAQARLKDL
EALLNSKEAALSTALSEKRTLEGELHDLRGQVAKL
EAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQ
KNIYSEELRE
Storage
-20C
Provider Type Product Number
- No reagents -