HPA011992

KCNJ10 antibody from Sigma-Aldrich
Kir1.2, Kir4.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011992
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011992, RRID:AB_1855559
Product name
Anti-KCNJ10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011992
Antibody type
Polyclonal
Antigen
ATP-sensitive inward rectifier potassium channel 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGC
QVTGKLLQTHQS
Storage
-20C
Provider Type Product Number
- No reagents -