Antibody data

Product number
H00006278-M07A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006278-M07A, RRID:AB_1580334
Product name
S100A7 monoclonal antibody (M07A), clone 3E11
Provider product page
Abnova Corporation - H00006278-M07A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant S100A7.
Antigen sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTM
MKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKI
DFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Isotype
IgG
Antibody clone number
3E11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -