Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006278-M07A - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006278-M07A, RRID:AB_1580334
- Product name
- S100A7 monoclonal antibody (M07A), clone 3E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant S100A7.
- Antigen sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTM
MKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKI
DFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ- Isotype
- IgG
- Antibody clone number
- 3E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of S100A7 expression in transfected 293T cell line by S100A7 monoclonal antibody (M07A), clone 3E11.Lane 1: S100A7 transfected lysate(11.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of S100A7 transfected lysate using anti-S100A7 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with S100A7 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol