Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006278-D03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006278-D03, RRID:AB_10719607
- Product name
- S100A7 MaxPab rabbit polyclonal antibody (D03)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human S100A7 protein.
- Antigen sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTM
MKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKI
DFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of S100A7 expression in transfected 293T cell line (H00006278-T01) by S100A7 MaxPab polyclonal antibody.Lane 1: S100A7 transfected lysate(11.22 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to S100A7 on HeLa cell. [antibody concentration 20 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of S100A7 transfected lysate using anti-S100A7 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with S100A7 purified MaxPab mouse polyclonal antibody (B01P) (H00006278-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol