Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - Immunocytochemistry [1]
 - Immunoprecipitation [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00006278-D03 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00006278-D03, RRID:AB_10719607
 - Product name
 - S100A7 MaxPab rabbit polyclonal antibody (D03)
 - Antibody type
 - Polyclonal
 - Description
 - Rabbit polyclonal antibody raised against a full-length human S100A7 protein.
 - Antigen sequence
 MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTM
MKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKI
DFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ- Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western Blot analysis of S100A7 expression in transfected 293T cell line (H00006278-T01) by S100A7 MaxPab polyclonal antibody.Lane 1: S100A7 transfected lysate(11.22 KDa).Lane 2: Non-transfected lysate.
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunofluorescence of purified MaxPab antibody to S100A7 on HeLa cell. [antibody concentration 20 ug/ml]
 - Validation comment
 - Immunofluorescence
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunoprecipitation of S100A7 transfected lysate using anti-S100A7 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with S100A7 purified MaxPab mouse polyclonal antibody (B01P) (H00006278-B01P).
 - Validation comment
 - Immunoprecipitation
 - Protocol
 - Protocol