Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB30551 - Provider product page
- Provider
- Abnova Corporation
- Product name
- KPNA6 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human KPNA6.
- Antigen sequence
RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMF
DSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQL
ATTQKFR- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis with KPNA6 polyclonal antibody (Cat # PAB30551)Lane 1: Human cell line RT-4Lane 2: Human cell line U-251MG sp