HPA018863

KPNA6 antibody from Sigma-Aldrich
FLJ11249, IPOA7, KPNA7, MGC17918
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018863
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018863, RRID:AB_1852632
Product name
Anti-KPNA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018863
Antibody type
Polyclonal
Antigen
Importin subunit alpha-7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMF
DSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQL
ATTQKFR
Storage
-20C
Provider Type Product Number
- No reagents -