HPA018863

KPNA6 antibody from Atlas Antibodies
FLJ11249, IPOA7, KPNA7, MGC17918
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018863
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018863, RRID:AB_1234663
Product name
Anti-KPNA6
Provider product page
Atlas Antibodies - HPA018863
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMF
DSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQL
ATTQKFR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -