HPA018863
KPNA6 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative
FLJ11249, IPOA7, KPNA7, MGC17918
Eligible for validation within the Antibodypedia Validation Initiative
- Western blot
Supportive data in Antibodypedia
- Immunocytochemistry
- Supportive data in Antibodypedia
- Immunohistochemistry
- Supportive data in Antibodypedia
Antibody data
- Antibody Data
- Knockdown Reagents [0]
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018863
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018863, RRID:AB_1234663
- Product name
- Anti-KPNA6
- Provider product page
- Atlas Antibodies - HPA018863
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMF
DSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQL
ATTQKFR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Provider | Type | Product Number |
|---|---|---|
| - No reagents - | ||
