HPA020435

KCNMB1 antibody from Sigma-Aldrich
hslo-beta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020435
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020435, RRID:AB_1855550
Product name
Anti-KCNMB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020435
Antibody type
Polyclonal
Antigen
Calcium-activated potassium channel subunit beta-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAG
RWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADV
EKVRAKFQEQQVFYCFSAPRGNETSVLF
Storage
-20C
Provider Type Product Number
- No reagents -