HPA022144

ATP6V0A1 antibody from Sigma-Aldrich
a1, ATP6N1, ATP6N1A, Stv1, Vph1, VPP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022144
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022144, RRID:AB_1845189
Product name
Anti-ATP6V0A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022144
Antibody type
Polyclonal
Antigen
V-type proton ATPase 116 kDa subunit a isoform 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVE
KEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKI
ENELKEINTNQEALKRNFLELTELK
Storage
-20C
Provider Type Product Number
- No reagents -